| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM40773 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| Ki | 2.7±0.0 nM |
|---|
| Citation |  Chen, CA; Sieburth, SM; Glekas, A; Hewitt, GW; Trainor, GL; Erickson-Viitanen, S; Garber, SS; Cordova, B; Jeffry, S; Klabe, RM Drug design with a new transition state analog of the hydrated carbonyl: silicon-based inhibitors of the HIV protease. Chem Biol8:1161-6 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 protease wild type |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 10757.68 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | O90785 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
|---|
| BDBM40773 |
|---|
| n/a |
|---|
| Name | BDBM40773 |
|---|
| Synonyms: | Silanediol, 17b |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H42N2O6Si |
|---|
| Mol. Mass. | 650.8354 |
|---|
| SMILES | OC1Cc2ccccc2C1NC(=O)[C@H](Cc1ccccc1)C[Si](O)(O)C[C@@H](Cc1ccccc1)C(=O)NC1C(O)Cc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
