Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 protease
LigandBDBM517
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
Ki 0.37±0.0 nM
Citation Chen CASieburth SMGlekas AHewitt GWTrainor GLErickson-Viitanen SGarber SSCordova BJeffry SKlabe RM Drug design with a new transition state analog of the hydrated carbonyl: silicon-based inhibitors of the HIV protease. Chem Biol 8:1161-6 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
HIV-1 protease
Name:HIV-1 protease
Synonyms:HIV-1 protease wild type
Type:Protein
Mol. Mass.:10757.68
Organism:Human immunodeficiency virus
Description:O90785
Residue:99
Sequence:
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM517
n/a
NameBDBM517
Synonyms:(2S)-1-[(2S,4R)-4-benzyl-2-hydroxy-4-{[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]carbamoyl}butyl]-N-tert-butyl-4-(pyridin-3-ylmethyl)piperazine-2-carboxamide | CHEMBL115 | Crixivan | INDINAVIR SULFATE | Indinavir | Indinavir, 19 | L-735, 524 | MK639
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: