new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM32102
Substrate/Competitorn/a
Meas. Tech.Cathepsin S dose-response confirmation
IC50 176.463±16.4615 nM
Citation PubChem PC Cathepsin S dose-response confirmation PubChem Bioassay (2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32102
n/a
NameBDBM32102
Synonyms:1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7(1H,6H)-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,6-dimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000087831 | SMR000024051 | US9284299, PKF118-310 | US9738628, Compound PKF118-310 | cid_66541
TypeSmall organic molecule
Emp. Form.C7H7N5O2
Mol. Mass.193.1628
SMILESCn1ncnc2c1nc(=O)n(C)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: