BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM265753
Substrate/Competitorn/a
Meas. Tech.Human P2X3 Receptor Inhibition Assay
pH7.5±n/a
IC50 2.00±n/a nM
Commentsextracted
Citation Kai HHoriguchi TAsahi KFujii Y Triazine derivative and pharmaceutical composition having an analgesic activity comprising the same US Patent  US9718790 Publication Date 8/1/2017  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2RX3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor
Type:Protein
Mol. Mass.:44292.02
Organism:Homo sapiens (Human)
Description:P56373
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM265753
n/a
NameBDBM265753
Synonyms:US9718790, I-1990
TypeSmall organic molecule
Emp. Form.C24H31N5O4S
Mol. Mass.485.599
SMILESCCOC(=O)CCn1c(=O)[nH]\c(=N/c2ccc3nc(C)sc3c2)n(CC2CCC(C)CC2)c1=O |(9.96,2.31,;8.62,3.08,;7.29,2.31,;5.96,3.08,;5.96,4.62,;4.62,2.31,;3.29,3.08,;1.95,2.31,;.62,3.08,;.62,4.62,;-.71,2.31,;-.71,.77,;-2.05,,;-3.38,.77,;-3.38,2.31,;-4.71,3.08,;-6.05,2.31,;-7.51,2.79,;-8.42,1.54,;-9.96,1.54,;-7.51,.29,;-6.05,.77,;-4.71,,;.62,,;.62,-1.54,;1.95,-2.31,;1.95,-3.85,;3.29,-4.62,;4.62,-3.85,;5.96,-4.62,;4.62,-2.31,;3.29,-1.54,;1.95,.77,;3.29,,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: