BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM266936
Substrate/Competitorn/a
Meas. Tech.Human P2X3 Receptor Inhibition Assay
pH7.5±n/a
IC50 2.00±n/a nM
Commentsextracted
Citation Kai HHoriguchi TAsahi KFujii Y Triazine derivative and pharmaceutical composition having an analgesic activity comprising the same US Patent  US9718790 Publication Date 8/1/2017  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2RX3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor
Type:Protein
Mol. Mass.:44292.02
Organism:Homo sapiens (Human)
Description:P56373
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM266936
n/a
NameBDBM266936
Synonyms:US9718790, I-2682
TypeSmall organic molecule
Emp. Form.C27H26N6O6
Mol. Mass.530.5319
SMILESCOC(=O)CCn1c(=O)[nH]\c(=N/c2ccc(Oc3cccc(n3)C(N)=O)cc2)n(Cc2ccc(C)cc2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: