Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Reverse Transcriptase
LigandBDBM1889
Substrate/Competitor(rC)n.(dG)12-18
Meas. Tech.HIV-1 RT Assay
pH7.8±n/a
Temperature310.15±n/a K
IC50 6±n/a nM
Citation Bell FWCantrell ASHogberg MJaskunas SRJohansson NGJordan CLKinnick MDLind PMorin JMNoreen R Phenethylthiazolethiourea (PETT) compounds, a new class of HIV-1 reverse transcriptase inhibitors. 1. Synthesis and basic structure-activity relationship studies of PETT analogs. J Med Chem 38:4929-36 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Reverse Transcriptase
Name:HIV-1 Reverse Transcriptase
Synonyms:EC: 2.7.7.49
Type:Protein Complex
Mol. Mass.:115684
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Reverse Transcriptase Chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:64383.27
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:559
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAH
TNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPP
LVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQA
IYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKG
IGGNEQVDKLVSAGIRKVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Reverse Transcriptase Chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:51337.13
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:440
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1889
(rC)n.(dG)12-18
Name:(rC)n.(dG)12-18
Synonyms:n/a
Type:RNA-DNA duplex
Mol. Mass.:358.43
Organism:n/a
Description:The incorporation of Tritium-labeled dGTP onto a poly(rC):oligo(dG)template:primer.
Residue:3
Sequence:
n/a