Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMyristoyl-CoA:protein N-myristoyltransferase (Nmt)
LigandBDBM43856
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 4.6e+2± 0 nM
Citation Sogabe SMasubuchi MSakata KFukami TAMorikami KShiratori YEbiike HKawasaki KAoki YShimma ND'Arcy AWinkler FKBanner DWOhtsuka T Crystal structures of Candida albicans N-myristoyltransferase with two distinct inhibitors. Chem Biol 9:1119-28 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Myristoyl-CoA:protein N-myristoyltransferase (Nmt)
Name:Myristoyl-CoA:protein N-myristoyltransferase (Nmt)
Synonyms:Myristoyl-CoA:protein N-myristoyltransferase | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D110A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D112A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D412A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F115A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F117A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F240A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F339A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F339S)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt G413A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt H227A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt I111A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt I352A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L350V)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L451A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L451Q)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt N175A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt P229A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt S241A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt T114A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt T211A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt V108A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt W232A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y107A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y119A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y225A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y256A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y354A)) | NMT | Peptide N-myristoyltransferase | Peptide N-myristoyltransferase 1
Type:Enzyme
Mol. Mass.:51875.96
Organism:Candida albicans (Yeast)
Description:P30418
Residue:451
Sequence:
MSGDNTGNKSNSAPSKSIEELLKLLAMGQELSPAQQKEMKDYKFWKTQPVPSLSETVTEE
GPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYS
HEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIH
KKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGF
SHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEF
KHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYAS
DSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLF
NYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43856
n/a
NameBDBM43856
Synonyms:4-ethoxy-N-[(6-fluoro-1,1-diketo-2,3-dihydrothiochromen-4-ylidene)amino]benzenesulfonamide | 4-ethoxy-N-[(6-fluoro-1,1-dioxo-2,3-dihydro-1-benzothiopyran-4-ylidene)amino]benzenesulfonamide | 4-ethoxy-N-[(6-fluoro-1,1-dioxo-2,3-dihydrothiochromen-4-ylidene)amino]benzenesulfonamide | 4-ethoxy-N-[[6-fluoranyl-1,1-bis(oxidanylidene)-2,3-dihydrothiochromen-4-ylidene]amino]benzenesulfonamide | MLS000761277 | Non peptidic, 3 | SMR000369580 | cid_3596078
TypeSmall organic molecule
Emp. Form.C17H17FN2O5S2
Mol. Mass.412.456
SMILESCCOc1ccc(cc1)S(=O)(=O)NN=C1CCS(=O)(=O)c2ccc(F)cc12 |w:13.13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: