new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM31759
Substrate/Competitorn/a
Meas. Tech.Fluorescent secondary assay for dose-response confirmation of chemical inhibitors of HePTP
IC50 240±n/a nM
Citation PubChem PC Fluorescent secondary assay for dose-response confirmation of chemical inhibitors of HePTP PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31759
n/a
NameBDBM31759
Synonyms:2-[5-[(Z)-(3-bromanyl-8-oxidanylidene-[1,3]thiazolo[4,5]imidazo[1,2-b]pyridin-7-ylidene)methyl]furan-2-yl]benzoic acid | 2-[5-[(Z)-(3-bromo-8-keto-thiazolo[4,5]imidazo[1,2-b]pyridin-7-ylidene)methyl]-2-furyl]benzoic acid | 2-[5-[(Z)-(3-bromo-8-oxo-7-thiazolo[4,5]imidazo[1,2-b]pyridinylidene)methyl]-2-furanyl]benzoic acid | 2-[5-[(Z)-(3-bromo-8-oxo-[1,3]thiazolo[4,5]imidazo[1,2-b]pyridin-7-ylidene)methyl]furan-2-yl]benzoic acid | MLS-0090801.0001 | cid_1357397
TypeSmall organic molecule
Emp. Form.C20H10BrN3O4S
Mol. Mass.468.28
SMILESOC(=O)c1ccccc1-c1ccc(\C=c2/sc3nc4cc(Br)cnc4n3c2=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: