Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 10 [11-204] |
---|
Ligand | BDBM32274 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein. |
---|
EC50 | 3420±n/a nM |
---|
Citation | PubChem, PC Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein. PubChem Bioassay(2008)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-like protein 10 [11-204] |
---|
Name: | Bcl-2-like protein 10 [11-204] |
Synonyms: | Apoptosis regulator Bcl-B (Bcl-2-like 10 protein) (Bcl2-L-10) (Anti-apoptotic protein NrH). | B2L10_HUMAN | BCL-B | BCL2L10 | BCLB | BOO | DIVA |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21981.77 |
Organism: | Homo sapiens (Human) |
Description: | gi_23396469 |
Residue: | 194 |
Sequence: | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY
PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ
EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC
LLTTAFIYLWTRLL
|
|
|
BDBM32274 |
---|
n/a |
---|
Name | BDBM32274 |
Synonyms: | 2,5-bis(chloranyl)-3-(4-methylpiperazin-1-yl)-6-(2-piperidin-1-yl-1,3-thiazol-5-yl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(4-methyl-1-piperazinyl)-6-[2-(1-piperidinyl)-1,3-thiazol-5-yl]benzo-1,4-quinone | 2,5-dichloro-3-(4-methyl-1-piperazinyl)-6-[2-(1-piperidinyl)-5-thiazolyl]cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(4-methylpiperazin-1-yl)-6-(2-piperidin-1-yl-1,3-thiazol-5-yl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-(4-methylpiperazino)-6-(2-piperidinothiazol-5-yl)-p-benzoquinone | MLS000548207 | SMR000115103 | cid_1002249 |
Type | Small organic molecule |
Emp. Form. | C19H22Cl2N4O2S |
Mol. Mass. | 441.375 |
SMILES | CN1CCN(CC1)C1=C(Cl)C(=O)C(c2cnc(s2)N2CCCCC2)=C(Cl)C1=O |c:8,t:26| |
Structure |
|