Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 2 |
---|
Ligand | BDBM33066 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W. |
---|
EC50 | 50±n/a nM |
---|
Citation | PubChem, PC Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W. PubChem Bioassay(2008)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-like protein 2 |
---|
Name: | Bcl-2-like protein 2 |
Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
Type: | Protein |
Mol. Mass.: | 20742.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 193 |
Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
BDBM33066 |
---|
n/a |
---|
Name | BDBM33066 |
Synonyms: | 2,5-bis(chloranyl)-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-pyrrolidin-1-yl-cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-(1-pyrrolidinyl)benzo-1,4-quinone | 2,5-dichloro-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-pyrrolidin-1-ylcyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)-5-thiazolyl]-6-(1-pyrrolidinyl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)thiazol-5-yl]-6-pyrrolidino-p-benzoquinone | MLS000548208 | SMR000115102 | cid_1002248 |
Type | Small organic molecule |
Emp. Form. | C15H15Cl2N3O2S |
Mol. Mass. | 372.27 |
SMILES | CN(C)c1ncc(s1)C1=C(Cl)C(=O)C(N2CCCC2)=C(Cl)C1=O |c:9,t:20| |
Structure |
|