new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 8
LigandBDBM47697
Substrate/Competitorn/a
Meas. Tech.Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao.
EC50>30000±n/a nM
Citation PubChem PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Regulator of G-protein signaling 8
Name:Regulator of G-protein signaling 8
Synonyms:Regulator of G-protein signaling 8 (RGS8)
Type:Enzyme Catalytic Domain
Mol. Mass.:20925.80
Organism:Homo sapiens (Human)
Description:gi_74355113
Residue:180
Sequence:
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47697
n/a
NameBDBM47697
Synonyms:MLS000071118 | SMR000003789 | [2-(2,3-dihydro-1H-inden-5-ylamino)-3-pyridinyl]-(4-morpholinyl)methanone | [2-(2,3-dihydro-1H-inden-5-ylamino)pyridin-3-yl]-morpholin-4-yl-methanone | [2-(2,3-dihydro-1H-inden-5-ylamino)pyridin-3-yl]-morpholin-4-ylmethanone | [2-(Indan-5-ylamino)-pyridin-3-yl]-morpholin-4-yl-methanone | [2-(indan-5-ylamino)-3-pyridyl]-morpholino-methanone | cid_651142
TypeSmall organic molecule
Emp. Form.C19H21N3O2
Mol. Mass.323.3889
SMILESO=C(N1CCOCC1)c1cccnc1Nc1ccc2CCCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: