new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRGS7
LigandBDBM32760
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
EC50>30000±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RGS7
Name:RGS7
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57675.72
Organism:Homo sapiens (Human)
Description:P49802
Residue:495
Sequence:
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32760
n/a
NameBDBM32760
Synonyms:3-[(2-chlorophenyl)methyl]-N-(2-morpholin-4-ylethyl)-[1,2,3]triazolo[4,5-d]pyrimidin-7-amine | 3-[(2-chlorophenyl)methyl]-N-(2-morpholin-4-ylethyl)triazolo[4,5-d]pyrimidin-7-amine | 3-[(2-chlorophenyl)methyl]-N-[2-(4-morpholinyl)ethyl]-7-triazolo[4,5-d]pyrimidinamine | MLS000034167 | SMR000007989 | [3-(2-Chloro-benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidin-7-yl]-(2-morpholin-4-yl-ethyl)-amine | [3-(2-chlorobenzyl)triazolo[4,5-d]pyrimidin-7-yl]-(2-morpholinoethyl)amine | cid_653228
TypeSmall organic molecule
Emp. Form.C17H20ClN7O
Mol. Mass.373.84
SMILESClc1ccccc1Cn1nnc2c(NCCN3CCOCC3)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: