new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRGS7
LigandBDBM47699
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
EC50>30000±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RGS7
Name:RGS7
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57675.72
Organism:Homo sapiens (Human)
Description:P49802
Residue:495
Sequence:
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47699
n/a
NameBDBM47699
Synonyms:2-[[4-(2-oxolanylmethylamino)-2-quinazolinyl]amino]phenol;hydrochloride | 2-[[4-(oxolan-2-ylmethylamino)quinazolin-2-yl]amino]phenol;hydrochloride | 2-[[4-(tetrahydrofurfurylamino)quinazolin-2-yl]amino]phenol;hydrochloride | 2-{4-[(Tetrahydro-furan-2-ylmethyl)-amino]-quinazolin-2-ylamino}-phenol | MLS000026785 | SMR000014427 | cid_6602541
TypeSmall organic molecule
Emp. Form.C19H20N4O2
Mol. Mass.336.3877
SMILESOc1ccccc1Nc1nc(NCC2CCCO2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: