new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRGS7
LigandBDBM40034
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
EC50>30000±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RGS7
Name:RGS7
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57675.72
Organism:Homo sapiens (Human)
Description:P49802
Residue:495
Sequence:
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM40034
n/a
NameBDBM40034
Synonyms:MLS000093573 | N-(3-keto-4-methyl-1,4-benzothiazin-6-yl)-4-piperidino-piperidine-1-carboxamide | N-(4-methyl-3-oxidanylidene-1,4-benzothiazin-6-yl)-4-piperidin-1-yl-piperidine-1-carboxamide | N-(4-methyl-3-oxo-1,4-benzothiazin-6-yl)-4-(1-piperidinyl)-1-piperidinecarboxamide | N-(4-methyl-3-oxo-1,4-benzothiazin-6-yl)-4-piperidin-1-ylpiperidine-1-carboxamide | N-(4-methyl-3-oxo-3,4-dihydro-2H-1,4-benzothiazin-6-yl)-1,4'-bipiperidine-1'-carboxamide | SMR000029191 | cid_3241667
TypeSmall organic molecule
Emp. Form.C20H28N4O2S
Mol. Mass.388.527
SMILESCN1C(=O)CSc2ccc(NC(=O)N3CCC(CC3)N3CCCCC3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: