| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 19 |
|---|
| Ligand | BDBM38361 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao. |
|---|
| EC50 | 1020±n/a nM |
|---|
| Citation |  PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 19 |
|---|
| Name: | Regulator of G-protein signaling 19 |
|---|
| Synonyms: | G protein signalling regulator 19 | GAIP | GNAI3IP | RGS19 | RGS19_HUMAN | Regulator of G-protein signaling 19 (RGS19) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 24631.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_86990435 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQ
ASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
|
|
|
|---|
| BDBM38361 |
|---|
| n/a |
|---|
| Name | BDBM38361 |
|---|
| Synonyms: | 2-(4-pyrrolidin-1-ylsulfonylphenyl)-1,2-benzothiazol-3-one | 2-(4-pyrrolidinosulfonylphenyl)-1,2-benzothiazol-3-one | 2-[4-(1-pyrrolidinylsulfonyl)phenyl]-1,2-benzothiazol-3-one | MLS000055723 | SMR000060746 | cid_2325816 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H16N2O3S2 |
|---|
| Mol. Mass. | 360.451 |
|---|
| SMILES | O=c1n(sc2ccccc12)-c1ccc(cc1)S(=O)(=O)N1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
