Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 19 |
---|
Ligand | BDBM47706 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao. |
---|
EC50 | >30000±n/a nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 19 |
---|
Name: | Regulator of G-protein signaling 19 |
Synonyms: | G protein signalling regulator 19 | GAIP | GNAI3IP | RGS19 | RGS19_HUMAN | Regulator of G-protein signaling 19 (RGS19) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 24631.38 |
Organism: | Homo sapiens (Human) |
Description: | gi_86990435 |
Residue: | 217 |
Sequence: | MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQ
ASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
|
|
|
BDBM47706 |
---|
n/a |
---|
Name | BDBM47706 |
Synonyms: | 2-[(4,5-dibenzyl-1,2,4-triazol-3-yl)sulfanyl]-N-(5-methyl-1,3,4-thiadiazol-2-yl)acetamide | 2-[(4,5-dibenzyl-1,2,4-triazol-3-yl)thio]-N-(5-methyl-1,3,4-thiadiazol-2-yl)acetamide | 2-[(4,5-dibenzyl-4H-1,2,4-triazol-3-yl)thio]-N-(5-methyl-1,3,4-thiadiazol-2-yl)acetamide | 2-[[4,5-bis(phenylmethyl)-1,2,4-triazol-3-yl]sulfanyl]-N-(5-methyl-1,3,4-thiadiazol-2-yl)ethanamide | 2-[[4,5-bis(phenylmethyl)-1,2,4-triazol-3-yl]thio]-N-(5-methyl-1,3,4-thiadiazol-2-yl)acetamide | MLS000051063 | SMR000078897 | cid_1260067 |
Type | Small organic molecule |
Emp. Form. | C21H20N6OS2 |
Mol. Mass. | 436.553 |
SMILES | Cc1nnc(NC(=O)CSc2nnc(Cc3ccccc3)n2Cc2ccccc2)s1 |
Structure |
|