Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 16 |
---|
Ligand | BDBM34513 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao. |
---|
EC50 | 1760±n/a nM |
---|
Citation | PubChem, PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 16 |
---|
Name: | Regulator of G-protein signaling 16 |
Synonyms: | RGS16 | RGS16_HUMAN | RGSR | Regulator of G-protein signaling 16 (RGS16) | regulator of G-protein signalling 16 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 22748.87 |
Organism: | Homo sapiens (Human) |
Description: | gi_156416009 |
Residue: | 202 |
Sequence: | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
|
|
|
BDBM34513 |
---|
n/a |
---|
Name | BDBM34513 |
Synonyms: | MLS000118887 | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(3-keto-4,6-dimethyl-isothiazolo[5,4-b]pyridin-2-yl)acetamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxidanylidene-[1,2]thiazolo[5,4-b]pyridin-2-yl)ethanamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxo-2-isothiazolo[5,4-b]pyridinyl)acetamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxo-[1,2]thiazolo[5,4-b]pyridin-2-yl)acetamide | SMR000095827 | US9011882, Table 1, Compound 15 | cid_5309169 |
Type | Small organic molecule |
Emp. Form. | C20H23N3O4S |
Mol. Mass. | 401.479 |
SMILES | COc1ccc(OC)c(CCNC(=O)Cn2sc3nc(C)cc(C)c3c2=O)c1 |
Structure |
|