| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 16 |
|---|
| Ligand | BDBM47783 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao. |
|---|
| EC50 | >30000±n/a nM |
|---|
| Citation |  PubChem, PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 16 |
|---|
| Name: | Regulator of G-protein signaling 16 |
|---|
| Synonyms: | RGS16 | RGS16_HUMAN | RGSR | Regulator of G-protein signaling 16 (RGS16) | regulator of G-protein signalling 16 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22748.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_156416009 |
|---|
| Residue: | 202 |
|---|
| Sequence: | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
|
|
|
|---|
| BDBM47783 |
|---|
| n/a |
|---|
| Name | BDBM47783 |
|---|
| Synonyms: | 4-[(2-chloranyl-6-fluoranyl-phenyl)methylideneamino]-3-pyridin-3-yl-1H-1,2,4-triazole-5-thione | 4-[(2-chloro-6-fluoro-benzylidene)amino]-3-(3-pyridyl)-1H-1,2,4-triazole-5-thione | 4-[(2-chloro-6-fluorobenzylidene)amino]-5-(3-pyridinyl)-4H-1,2,4-triazole-3-thiol | 4-[(2-chloro-6-fluorophenyl)methylideneamino]-3-(3-pyridinyl)-1H-1,2,4-triazole-5-thione | 4-[(2-chloro-6-fluorophenyl)methylideneamino]-3-pyridin-3-yl-1H-1,2,4-triazole-5-thione | MLS000677590 | SMR000271762 | cid_806179 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H9ClFN5S |
|---|
| Mol. Mass. | 333.771 |
|---|
| SMILES | Fc1cccc(Cl)c1C=Nn1c(n[nH]c1=S)-c1cccnc1 |w:9.10| |
|---|
| Structure | 
|
|---|
Search and Browse
