new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM4078
Substrate/Competitorn/a
Meas. Tech.Dose Response Confirmation for Mcl-1/Noxa Interaction Inhibitors
IC50 54000±n/a nM
Citation PubChem PC Dose Response Confirmation for Mcl-1/Noxa Interaction Inhibitors PubChem Bioassay (2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4078
n/a
NameBDBM4078
Synonyms:6,7,13,14-tetrahydroxy-2,9-dioxatetracyclo[6.6.2.0^{4,16}.0^{11,15}]hexadeca-1(14),4(16),5,7,11(15),12-hexaene-3,10-dione | CHEMBL6246 | ELLAGIC ACID | Elagic Acid | Ellagic acid (18) | Ellagic acid dihydrate | MLS000069632 | SMR000058244 | cid_5281855
TypeSmall organic molecule
Emp. Form.C14H6O8
Mol. Mass.302.1926
SMILESOc1cc2c3c(oc(=O)c4cc(O)c(O)c(oc2=O)c34)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: