| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 4 |
|---|
| Ligand | BDBM41758 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. |
|---|
| EC50 | 30000±n/a nM |
|---|
| Citation |  PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 4 |
|---|
| Name: | Regulator of G-protein signaling 4 |
|---|
| Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23263.51 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49798 |
|---|
| Residue: | 205 |
|---|
| Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
|---|
| BDBM41758 |
|---|
| n/a |
|---|
| Name | BDBM41758 |
|---|
| Synonyms: | (2-{2-[5-(4-Fluoro-phenyl)-[1,3,4]oxadiazol-2-ylsulfanyl]-acetylamino}-thiazol-4-yl)-acetic acid ethyl ester | 2-[2-[[2-[[5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl]thio]-1-oxoethyl]amino]-4-thiazolyl]acetic acid ethyl ester | 2-[2-[[2-[[5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl]thio]acetyl]amino]thiazol-4-yl]acetic acid ethyl ester | MLS000071801 | SMR000003120 | cid_653271 | ethyl 2-[2-[2-[[5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl]sulfanyl]ethanoylamino]-1,3-thiazol-4-yl]ethanoate | ethyl 2-[2-[[2-[[5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl]sulfanyl]acetyl]amino]-1,3-thiazol-4-yl]acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15FN4O4S2 |
|---|
| Mol. Mass. | 422.454 |
|---|
| SMILES | CCOC(=O)Cc1csc(NC(=O)CSc2nnc(o2)-c2ccc(F)cc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
