| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 4 |
|---|
| Ligand | BDBM47702 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. |
|---|
| EC50 | 30000±n/a nM |
|---|
| Citation |  PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 4 |
|---|
| Name: | Regulator of G-protein signaling 4 |
|---|
| Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23263.51 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49798 |
|---|
| Residue: | 205 |
|---|
| Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
|---|
| BDBM47702 |
|---|
| n/a |
|---|
| Name | BDBM47702 |
|---|
| Synonyms: | MLS000089261 | N-(5-methyl-2-pyridin-2-yl-pyrazol-3-yl)cyclobutanecarboxamide | N-(5-methyl-2-pyridin-2-ylpyrazol-3-yl)cyclobutanecarboxamide | N-[5-methyl-2-(2-pyridinyl)-3-pyrazolyl]cyclobutanecarboxamide | N-[5-methyl-2-(2-pyridyl)pyrazol-3-yl]cyclobutanecarboxamide | SMR000062562 | cid_2997575 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H16N4O |
|---|
| Mol. Mass. | 256.303 |
|---|
| SMILES | Cc1cc(NC(=O)C2CCC2)n(n1)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
