new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetregulator of G-protein signaling 4
LigandBDBM46667
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao.
EC50 30000±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. PubChem Bioassay (2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
regulator of G-protein signaling 4
Name:Regulator of G-protein signaling 4 (RGS4)
Synonyms:RGP4 | RGS4
Type:Enzyme
Mol. Mass.:23263.51
Organism:Homo sapiens (Human)
Description:P49798
Residue:205
Sequence:
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46667
n/a
NameBDBM46667
Synonyms:2-phenyl-1,2-benzothiazol-3-one | 2-phenyl-1,2-benzothiazol-3-one (1) | MLS-0107957.0001 | cid_164981
TypeSmall organic molecule
Emp. Form.C13H9NOS
Mol. Mass.227.282
SMILESO=c1n(sc2ccccc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: