new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase (VHR)
LigandBDBM4078
Substrate/Competitorn/a
Meas. Tech.Fluorescent assay for identification of compounds that inhibit VHR1
IC50 1230±n/a nM
Citation PubChem PC Fluorescent assay for identification of compounds that inhibit VHR1 PubChem Bioassay (2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity protein phosphatase (VHR)
Name:Dual specificity protein phosphatase 3
Synonyms:Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR
Type:Hydrolase
Mol. Mass.:20480.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:185
Sequence:
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4078
n/a
NameBDBM4078
Synonyms:6,7,13,14-tetrahydroxy-2,9-dioxatetracyclo[6.6.2.0^{4,16}.0^{11,15}]hexadeca-1(14),4(16),5,7,11(15),12-hexaene-3,10-dione | CHEMBL6246 | ELLAGIC ACID | Elagic Acid | Ellagic acid (18) | Ellagic acid dihydrate | MLS000069632 | SMR000058244 | cid_5281855
TypeSmall organic molecule
Emp. Form.C14H6O8
Mol. Mass.302.1926
SMILESOc1cc2c3c(oc(=O)c4cc(O)c(O)c(oc2=O)c34)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: