new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMKP-3
LigandBDBM51783
Substrate/Competitorn/a
Meas. Tech.MKP-3 in vitro HTS assay
IC50 30900±n/a nM
Citation PubChem PC MKP-3 in vitro HTS assay PubChem Bioassay (2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MKP-3
Name:MKP-3
Synonyms:MAP kinase phosphatase 3 | Mitogen-activated protein kinase phosphatase 3
Type:Enzyme
Mol. Mass.:42303.19
Organism:Rattus norvegicus
Description:gi_16758752
Residue:381
Sequence:
MIDTLRPVPFASEMAISKTVAWLNEQLELGNEQLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTAPSNQNVYQVDSLQST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51783
n/a
NameBDBM51783
Synonyms:3-[(5E)-5-[1-(2-chlorobenzyl)-2-keto-indolin-3-ylidene]-4-keto-2-thioxo-thiazolidin-3-yl]propionic acid | 3-[(5E)-5-[1-[(2-chlorophenyl)methyl]-2-oxidanylidene-indol-3-ylidene]-4-oxidanylidene-2-sulfanylidene-1,3-thiazolidin-3-yl]propanoic acid | 3-[(5E)-5-[1-[(2-chlorophenyl)methyl]-2-oxo-3-indolylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]propanoic acid | 3-[(5E)-5-[1-[(2-chlorophenyl)methyl]-2-oxoindol-3-ylidene]-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]propanoic acid | MLS001173336 | SMR000538928 | cid_1570081
TypeSmall organic molecule
Emp. Form.C21H15ClN2O4S2
Mol. Mass.458.938
SMILESOC(=O)CCN1C(=S)S\C(C1=O)=C1\C(=O)N(Cc2ccccc2Cl)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: