BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM31734
Substrate/Competitorn/a
Meas. Tech.HTS Discovery of Chemical Inhibitors of HePTP, a Leukemia Target
IC50 280±n/a nM
Citation PubChem PC HTS Discovery of Chemical Inhibitors of HePTP, a Leukemia Target PubChem Bioassay (2008)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31734
n/a
NameBDBM31734
Synonyms:8-carbethoxy-3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinoline-4-carboxylic acid | 8-ethoxycarbonyl-3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinoline-4-carboxylic acid | MLS-0025126.0001 | cid_2859888
TypeSmall organic molecule
Emp. Form.C16H17NO4
Mol. Mass.287.3105
SMILESCCOC(=O)c1ccc2NC(C3CC=CC3c2c1)C(O)=O |c:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: