| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cell division control protein 42 homolog |
|---|
| Ligand | BDBM54549 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Oxadiazole SAR compounds tested by Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Cdc42 activated mutant |
|---|
| Ki | 100±n/a nM |
|---|
| Citation |  PubChem, PC Oxadiazole SAR compounds tested by Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Cdc42 activated mutant PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cell division control protein 42 homolog |
|---|
| Name: | Cell division control protein 42 homolog |
|---|
| Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21258.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_652970 |
|---|
| Residue: | 191 |
|---|
| Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
|---|
| BDBM54549 |
|---|
| n/a |
|---|
| Name | BDBM54549 |
|---|
| Synonyms: | 1-[4-(2,5-dimethylphenyl)-1-piperazinyl]-3-(3-phenyl-1,2,4-oxadiazol-5-yl)-1-propanone | 1-[4-(2,5-dimethylphenyl)piperazin-1-yl]-3-(3-phenyl-1,2,4-oxadiazol-5-yl)propan-1-one | 1-[4-(2,5-dimethylphenyl)piperazino]-3-(3-phenyl-1,2,4-oxadiazol-5-yl)propan-1-one | KUC103356N | UNM-0000306070 | cid_25241706 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26N4O2 |
|---|
| Mol. Mass. | 390.4781 |
|---|
| SMILES | Cc1ccc(C)c(c1)N1CCN(CC1)C(=O)CCc1nc(no1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
