Reaction Details |
| Report a problem with these data |
Target | Cell division control protein 42 homolog |
---|
Ligand | BDBM22360 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Additional SAR compounds tested by Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Cdc42 activated mutant |
---|
EC50 | 30000±n/a nM |
---|
Citation | PubChem, PC Additional SAR compounds tested by Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Cdc42 activated mutant PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cell division control protein 42 homolog |
---|
Name: | Cell division control protein 42 homolog |
Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
Type: | PROTEIN |
Mol. Mass.: | 21258.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_652970 |
Residue: | 191 |
Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
BDBM22360 |
---|
n/a |
---|
Name | BDBM22360 |
Synonyms: | 2-(acetyloxy)benzoate | 2-(acetyloxy)benzoic acid | Acetylsalicylic acid | Aspirin | Endosprin | Polopirin | Zorprin | acetylsalicylate | cid_2244 |
Type | Anti-Inflammatory Agents, Non-Steroidal |
Emp. Form. | C9H8O4 |
Mol. Mass. | 180.1574 |
SMILES | CC(=O)Oc1ccccc1C(O)=O |
Structure |
|