| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ras-related protein Rab-7a |
|---|
| Ligand | BDBM50110164 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab7 wildtype |
|---|
| EC50 | 41210±n/a nM |
|---|
| Citation |  PubChem, PC Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab7 wildtype PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ras-related protein Rab-7a |
|---|
| Name: | Ras-related protein Rab-7a |
|---|
| Synonyms: | GTP-binding protein (rab7) | RAB7 | RAB7A | RAB7A_CANLF |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23519.50 |
|---|
| Organism: | Canis lupus familiaris |
|---|
| Description: | gi_164058 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKTSAESCSC
|
|
|
|---|
| BDBM50110164 |
|---|
| n/a |
|---|
| Name | BDBM50110164 |
|---|
| Synonyms: | (Z)-2-(3-(4-(methylthio)benzylidene)-6-fluoro-2-methyl-3H-inden-1-yl)acetic acid | 2-(3-(4-(methylthio)benzylidene)-6-fluoro-2-methyl-3H-inden-1-yl)acetic acid | CHEMBL18797 | SULINDAC SULFIDE | Sulindac sulphide | [6-Fluoro-2-methyl-3-(4-methylsulfanyl-benzylidene)-3H-inden-1-yl]-acetic acid | cid_5352624 | {6-Fluoro-2-methyl-3-[1-(4-methylsulfanyl-phenyl)-meth-(E)-ylidene]-3H-inden-1-yl}-acetic acid | {6-Fluoro-2-methyl-3-[1-[4-(methyl-lambda*4*-sulfanyl)-phenyl]-meth-(E)-ylidene]-3H-inden-1-yl}-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17FO2S |
|---|
| Mol. Mass. | 340.411 |
|---|
| SMILES | CSc1ccc(\C=C2\C(C)=C(CC(O)=O)c3cc(F)ccc23)cc1 |t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
