Reaction Details |
| Report a problem with these data |
Target | Cell division control protein 42 homolog |
---|
Ligand | BDBM54550 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Oxadiazole SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Cdc42 wildtype |
---|
Ki | 330±n/a nM |
---|
Citation | PubChem, PC Oxadiazole SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Cdc42 wildtype PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cell division control protein 42 homolog |
---|
Name: | Cell division control protein 42 homolog |
Synonyms: | CDC42 | CDC42_HUMAN | Cell division control protein 42 homolog | G25K GTP-binding protein | cell division cycle 42 (GTP binding protein, 25kDa) |
Type: | PROTEIN |
Mol. Mass.: | 21258.36 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_652970 |
Residue: | 191 |
Sequence: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
|
|
|
BDBM54550 |
---|
n/a |
---|
Name | BDBM54550 |
Synonyms: | 1-[4-(2,5-dimethylphenyl)-1-piperazinyl]-3-[3-(2-methoxyphenyl)-1,2,4-oxadiazol-5-yl]-1-propanone | 1-[4-(2,5-dimethylphenyl)piperazin-1-yl]-3-[3-(2-methoxyphenyl)-1,2,4-oxadiazol-5-yl]propan-1-one | 1-[4-(2,5-dimethylphenyl)piperazino]-3-[3-(2-methoxyphenyl)-1,2,4-oxadiazol-5-yl]propan-1-one | KUC103357N | UNM-0000306071 | cid_25241707 |
Type | Small organic molecule |
Emp. Form. | C24H28N4O3 |
Mol. Mass. | 420.5041 |
SMILES | COc1ccccc1-c1noc(CCC(=O)N2CCN(CC2)c2cc(C)ccc2C)n1 |
Structure |
|