Reaction Details |
| Report a problem with these data |
Target | GTPase KRas [1-37] |
---|
Ligand | BDBM54607 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras wildtype |
---|
Ki | 10±n/a nM |
---|
Citation | PubChem, PC Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras wildtype PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
GTPase KRas [1-37] |
---|
Name: | GTPase KRas [1-37] |
Synonyms: | ras protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 4034.04 |
Organism: | Homo sapiens (Human) |
Description: | gi_190938 |
Residue: | 37 |
Sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIE
|
|
|
BDBM54607 |
---|
n/a |
---|
Name | BDBM54607 |
Synonyms: | 4-(2,5-diphenyl-3,4-dihydropyrazol-3-yl)-N,N-dimethyl-aniline | 4-(2,5-diphenyl-3,4-dihydropyrazol-3-yl)-N,N-dimethylaniline | UNM-0000305845 | [4-(2,5-diphenyl-2-pyrazolin-3-yl)phenyl]-dimethyl-amine | cid_2729182 |
Type | Small organic molecule |
Emp. Form. | C23H23N3 |
Mol. Mass. | 341.4488 |
SMILES | CN(C)c1ccc(cc1)C1CC(=NN1c1ccccc1)c1ccccc1 |c:12| |
Structure |
|