Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 7 |
---|
Ligand | BDBM31759 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds |
---|
IC50 | 159±n/a nM |
---|
Citation | PubChem, PC MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 7 |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 7 |
Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
Type: | Protein |
Mol. Mass.: | 40530.79 |
Organism: | Homo sapiens (Human) |
Description: | P35236 |
Residue: | 360 |
Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
BDBM31759 |
---|
n/a |
---|
Name | BDBM31759 |
Synonyms: | 2-[5-[(Z)-(3-bromanyl-8-oxidanylidene-[1,3]thiazolo[4,5]imidazo[1,2-b]pyridin-7-ylidene)methyl]furan-2-yl]benzoic acid | 2-[5-[(Z)-(3-bromo-8-keto-thiazolo[4,5]imidazo[1,2-b]pyridin-7-ylidene)methyl]-2-furyl]benzoic acid | 2-[5-[(Z)-(3-bromo-8-oxo-7-thiazolo[4,5]imidazo[1,2-b]pyridinylidene)methyl]-2-furanyl]benzoic acid | 2-[5-[(Z)-(3-bromo-8-oxo-[1,3]thiazolo[4,5]imidazo[1,2-b]pyridin-7-ylidene)methyl]furan-2-yl]benzoic acid | MLS-0090801.0001 | cid_1357397 |
Type | Small organic molecule |
Emp. Form. | C20H10BrN3O4S |
Mol. Mass. | 468.28 |
SMILES | OC(=O)c1ccccc1-c1ccc(\C=c2/sc3nc4cc(Br)cnc4n3c2=O)o1 |
Structure |
|