new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM44469
Substrate/Competitorn/a
Meas. Tech.MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds
IC50 1050±n/a nM
Citation PubChem PC MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM44469
n/a
NameBDBM44469
Synonyms:2,3-bis(2-furanyl)-N-(2-phenylethyl)-6-quinoxalinecarboxamide | 2,3-bis(2-furyl)-N-phenethyl-quinoxaline-6-carboxamide | 2,3-bis(furan-2-yl)-N-(2-phenylethyl)quinoxaline-6-carboxamide | MLS000520651 | SMR000131061 | cid_5076888
TypeSmall organic molecule
Emp. Form.C25H19N3O3
Mol. Mass.409.4367
SMILESO=C(NCCc1ccccc1)c1ccc2nc(-c3ccco3)c(nc2c1)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: