new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM46217
Substrate/Competitorn/a
Meas. Tech.MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds
IC50 30200±n/a nM
Citation PubChem PC MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46217
n/a
NameBDBM46217
Synonyms:2-(2-dibenzothiophenyloxy)-2-methylpropanoic acid | 2-dibenzothiophen-2-yloxy-2-methyl-propanoic acid | 2-dibenzothiophen-2-yloxy-2-methyl-propionic acid | 2-dibenzothiophen-2-yloxy-2-methylpropanoic acid | MLS-0412044.0001 | cid_901652
TypeSmall organic molecule
Emp. Form.C16H14O3S
Mol. Mass.286.346
SMILESCC(C)(Oc1ccc2sc3ccccc3c2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: