| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM30741 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1 |
|---|
| EC50 | 4920±n/a nM |
|---|
| Citation |  PubChem, PC Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1 PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 20130.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
|---|
| BDBM30741 |
|---|
| n/a |
|---|
| Name | BDBM30741 |
|---|
| Synonyms: | 2-amino-6-(4-chlorophenyl)-4-(5-methyl-3-furanyl)-3-pyridinecarbonitrile | 2-amino-6-(4-chlorophenyl)-4-(5-methyl-3-furyl)nicotinonitrile | 2-amino-6-(4-chlorophenyl)-4-(5-methylfuran-3-yl)pyridine-3-carbonitrile | 2-azanyl-6-(4-chlorophenyl)-4-(5-methylfuran-3-yl)pyridine-3-carbonitrile | MLS000036685 | SMR000041039 | cid_660120 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H12ClN3O |
|---|
| Mol. Mass. | 309.75 |
|---|
| SMILES | Cc1cc(co1)-c1cc(nc(N)c1C#N)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
