Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM430
Substrate/CompetitorPeptide substrate
Meas. Tech.Protease Inhibition Assay
pH6.2±n/a
Temperature310.15±n/a K
Ki 0.03±n/a nM
Citation Prasad JVBoyer FEDomagala JMEllsworth ELGajda CHamilton HWHagen SEMarkoski LJSteinbaugh BATait BDHumblet CLunney EAPavlovsky ARubin JRFerguson DGraham NHoller THupe DNouhan CTummino PJUrumov AZeikus EZeikus GGracheck SJErickson JW Nonpeptidic HIV protease inhibitors possessing excellent antiviral activities and therapeutic indices. PD 178390: a lead HIV protease inhibitor. Bioorg Med Chem 7:2775-800 (1999) [PubMed]
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM430
Peptide substrate
Name:Peptide substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:4517.01
Organism:n/a
Description:n/a
Residue:41
Sequence:
H-His-Lys-Ala-Arg-Val-Leu(p-NO2)Phe-Glu-Ala-norleucine-Ser-N
H2