new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmitogen-activated protein kinase kinase kinase 3 isoform 1
LigandBDBM54954
Substrate/Competitorn/a
Meas. Tech.SAR Compounds tested by Dose Response Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 3 Wildtype.
EC50>30000±n/a nM
Citation PubChem PC SAR Compounds tested by Dose Response Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 3 Wildtype. PubChem Bioassay (2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
mitogen-activated protein kinase kinase kinase 3 isoform 1
Name:Mitogen-activated protein kinase kinase kinase 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:70916.05
Organism:Homo sapiens (Human)
Description:ChEMBL_774345
Residue:626
Sequence:
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM54954
n/a
NameBDBM54954
Synonyms:6-cyclohexyl-3-(2-pyridinyl)-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | 6-cyclohexyl-3-(2-pyridyl)-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | 6-cyclohexyl-3-pyridin-2-yl-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | VU0364704-1 | cid_936216
TypeSmall organic molecule
Emp. Form.C14H15N5S
Mol. Mass.285.367
SMILESC1CCC(CC1)c1nn2c(nnc2s1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: