Reaction Details |
 | Report a problem with these data |
Target | core protein |
---|
Ligand | BDBM50041802 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | TR-FRET-based biochemical high-throughput dose response assay to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization. |
---|
IC50 | >49751±n/a nM |
---|
Citation | PubChem PC TR-FRET-based biochemical high-throughput dose response assay to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization. PubChem Bioassay (2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
core protein |
---|
Name: | core protein |
Synonyms: | n/a |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 14237.71 |
Organism: | Hepatitis C virus |
Description: | gi_83779224 |
Residue: | 126 |
Sequence: | MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRG
RRQPIPKDQRTTGKSWGKPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRHRSRNVG
KVIDTL
|
|
|
BDBM50041802 |
---|
n/a |
---|
Name | BDBM50041802 |
Synonyms: | 1,8-dihydroxy-9(10H)-anthracenone | 1,8-dihydroxy-9-anthrone | 1,8-dihydroxyanthracen-9(10H)-one | 1,8-dihydroxyanthrone | CHEMBL46469 | US9182402, 15 | anthralin | cid_2202 | dithranol |
Type | Small organic molecule |
Emp. Form. | C14H10O3 |
Mol. Mass. | 226.2274 |
SMILES | Oc1cccc2Cc3cccc(O)c3C(=O)c12 |
Structure |
|