new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetcore protein
LigandBDBM50041802
Substrate/Competitorn/a
Meas. Tech.TR-FRET-based biochemical high-throughput dose response assay to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization.
IC50>49751±n/a nM
Citation PubChem PC TR-FRET-based biochemical high-throughput dose response assay to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
core protein
Name:core protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:14237.71
Organism:Hepatitis C virus
Description:gi_83779224
Residue:126
Sequence:
MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRG
RRQPIPKDQRTTGKSWGKPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRHRSRNVG
KVIDTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041802
n/a
NameBDBM50041802
Synonyms:1,8-dihydroxy-9(10H)-anthracenone | 1,8-dihydroxy-9-anthrone | 1,8-dihydroxyanthracen-9(10H)-one | 1,8-dihydroxyanthrone | CHEMBL46469 | US9182402, 15 | anthralin | cid_2202 | dithranol
TypeSmall organic molecule
Emp. Form.C14H10O3
Mol. Mass.226.2274
SMILESOc1cccc2Cc3cccc(O)c3C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: