| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2'-phosphotransferase |
|---|
| Ligand | BDBM44482 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of tRNA 2'-phosphotransferase (TPT1). |
|---|
| IC50 | 20491±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of tRNA 2'-phosphotransferase (TPT1). PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 2'-phosphotransferase |
|---|
| Name: | 2'-phosphotransferase |
|---|
| Synonyms: | likely tRNA 2'-phosphotransferase |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23631.37 |
|---|
| Organism: | Candida albicans SC5314 |
|---|
| Description: | gi_68476498 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MPPPDKARRDVLISKALSYLLRHGAEKEKLSIDDQGYVKISDVLSHQRLKSLKTTRDDIN
RIVQENDKKRFTIKDDMICANQGHSLKAVKNDNLTPMTVDELNQLRIYHGTYRTKLPLIK
SSGGLSKMNRNHIHFTCEQYSTCSGIRYNANVLIYINASKCIEHGIVFYKSLNNVILTSG
DKDGKLSWEFIDRIVGLDGNEINKEQV
|
|
|
|---|
| BDBM44482 |
|---|
| n/a |
|---|
| Name | BDBM44482 |
|---|
| Synonyms: | 2-[(5Z)-5-[(E)-3-(2-furanyl)prop-2-enylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]-3-methylbutanoic acid | 2-[(5Z)-5-[(E)-3-(2-furyl)prop-2-enylidene]-4-keto-2-thioxo-thiazolidin-3-yl]-3-methyl-butyric acid | 2-[(5Z)-5-[(E)-3-(furan-2-yl)prop-2-enylidene]-4-oxidanylidene-2-sulfanylidene-1,3-thiazolidin-3-yl]-3-methyl-butanoic acid | 2-[(5Z)-5-[(E)-3-(furan-2-yl)prop-2-enylidene]-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]-3-methylbutanoic acid | 2-{5-[(E)-3-Furan-2-yl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-3-methyl-butyric acid | MLS000551672 | SMR000145597 | cid_6393068 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15NO4S2 |
|---|
| Mol. Mass. | 337.414 |
|---|
| SMILES | CC(C)C(N1C(=S)S\C(=C/C=C/c2ccco2)C1=O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
