Reaction Details |
| Report a problem with these data |
Target | 2'-phosphotransferase |
---|
Ligand | BDBM52921 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of tRNA 2'-phosphotransferase (TPT1). |
---|
IC50 | >55688±n/a nM |
---|
Citation | PubChem, PC Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of tRNA 2'-phosphotransferase (TPT1). PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
2'-phosphotransferase |
---|
Name: | 2'-phosphotransferase |
Synonyms: | likely tRNA 2'-phosphotransferase |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 23631.37 |
Organism: | Candida albicans SC5314 |
Description: | gi_68476498 |
Residue: | 207 |
Sequence: | MPPPDKARRDVLISKALSYLLRHGAEKEKLSIDDQGYVKISDVLSHQRLKSLKTTRDDIN
RIVQENDKKRFTIKDDMICANQGHSLKAVKNDNLTPMTVDELNQLRIYHGTYRTKLPLIK
SSGGLSKMNRNHIHFTCEQYSTCSGIRYNANVLIYINASKCIEHGIVFYKSLNNVILTSG
DKDGKLSWEFIDRIVGLDGNEINKEQV
|
|
|
BDBM52921 |
---|
n/a |
---|
Name | BDBM52921 |
Synonyms: | (5E)-5-(3-ethoxy-4-hydroxy-benzylidene)-1-[2-(4-fluorophenyl)ethyl]barbituric acid | (5E)-5-[(3-ethoxy-4-hydroxyphenyl)methylidene]-1-[2-(4-fluorophenyl)ethyl]-1,3-diazinane-2,4,6-trione | (5E)-5-[(3-ethoxy-4-oxidanyl-phenyl)methylidene]-1-[2-(4-fluorophenyl)ethyl]-1,3-diazinane-2,4,6-trione | 5-[1-(3-Ethoxy-4-hydroxy-phenyl)-meth-(E)-ylidene]-1-[2-(4-fluoro-phenyl)-ethyl]-pyrimidine-2,4,6-trione | MLS000778165 | SMR000414559 | cid_5514790 |
Type | Small organic molecule |
Emp. Form. | C21H19FN2O5 |
Mol. Mass. | 398.3844 |
SMILES | CCOc1cc(\C=C2/C(=O)NC(=O)N(CCc3ccc(F)cc3)C2=O)ccc1O |
Structure |
|