| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2'-phosphotransferase |
|---|
| Ligand | BDBM51782 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of tRNA 2'-phosphotransferase (TPT1). |
|---|
| IC50 | 2439±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of tRNA 2'-phosphotransferase (TPT1). PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 2'-phosphotransferase |
|---|
| Name: | 2'-phosphotransferase |
|---|
| Synonyms: | likely tRNA 2'-phosphotransferase |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23631.37 |
|---|
| Organism: | Candida albicans SC5314 |
|---|
| Description: | gi_68476498 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MPPPDKARRDVLISKALSYLLRHGAEKEKLSIDDQGYVKISDVLSHQRLKSLKTTRDDIN
RIVQENDKKRFTIKDDMICANQGHSLKAVKNDNLTPMTVDELNQLRIYHGTYRTKLPLIK
SSGGLSKMNRNHIHFTCEQYSTCSGIRYNANVLIYINASKCIEHGIVFYKSLNNVILTSG
DKDGKLSWEFIDRIVGLDGNEINKEQV
|
|
|
|---|
| BDBM51782 |
|---|
| n/a |
|---|
| Name | BDBM51782 |
|---|
| Synonyms: | (5E)-5-(2-furanylmethylidene)-1-(2-methylphenyl)-2-sulfanylidene-1,3-diazinane-4,6-dione | (5E)-5-(2-furfurylidene)-1-(o-tolyl)-2-thioxo-hexahydropyrimidine-4,6-quinone | (5E)-5-(furan-2-ylmethylidene)-1-(2-methylphenyl)-2-sulfanylidene-1,3-diazinane-4,6-dione | MLS001163797 | SMR000539168 | cid_1557339 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12N2O3S |
|---|
| Mol. Mass. | 312.343 |
|---|
| SMILES | Cc1ccccc1N1C(=S)NC(=O)C(=Cc2ccco2)C1=O |w:14.15| |
|---|
| Structure | 
|
|---|
Search and Browse
