| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Guanyl-specific ribonuclease T1 |
|---|
| Ligand | BDBM51791 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of tRNA 2'-phosphotransferase (TPT1): fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of RNAse T1. |
|---|
| IC50 | >55688±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of tRNA 2'-phosphotransferase (TPT1): fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of RNAse T1. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Guanyl-specific ribonuclease T1 |
|---|
| Name: | Guanyl-specific ribonuclease T1 |
|---|
| Synonyms: | RNT1_ASPOR | rntA | unnamed protein product |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13952.57 |
|---|
| Organism: | Aspergillus oryzae |
|---|
| Description: | gi_83774548 |
|---|
| Residue: | 130 |
|---|
| Sequence: | MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVG
SNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTG
ASGNNFVECT
|
|
|
|---|
| BDBM51791 |
|---|
| n/a |
|---|
| Name | BDBM51791 |
|---|
| Synonyms: | 5-[(3,5-dimethyl-1-pyrazolyl)methyl]-N-[[5-(4-nitrophenyl)-2-furanyl]methylideneamino]-2-furancarboxamide | 5-[(3,5-dimethyl-1H-pyrazol-1-yl)methyl]-N'-[(5-{4-nitrophenyl}-2-furyl)methylene]-2-furohydrazide | 5-[(3,5-dimethylpyrazol-1-yl)methyl]-N-[[5-(4-nitrophenyl)-2-furyl]methyleneamino]-2-furamide | 5-[(3,5-dimethylpyrazol-1-yl)methyl]-N-[[5-(4-nitrophenyl)furan-2-yl]methylideneamino]furan-2-carboxamide | MLS001240080 | SMR000673320 | cid_1000028 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19N5O5 |
|---|
| Mol. Mass. | 433.4168 |
|---|
| SMILES | Cc1cc(C)n(Cc2ccc(o2)C(=O)N\N=C\c2ccc(o2)-c2ccc(cc2)[N+]([O-])=O)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
