new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 8 (mGlu8)
LigandBDBM50293743
Substrate/Competitorn/a
Meas. Tech.Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR8
EC50 13500±n/a nM
Citation PubChem PC Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR8 PubChem Bioassay (2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Metabotropic glutamate receptor 8 (mGlu8)
Name:Metabotropic glutamate receptor
Synonyms:GRM8 | glutamate receptor, metabotropic 8 precursor | mGlu8 | mGluR8 | metabotropic glutamate 8
Type:Enzyme
Mol. Mass.:101886.18
Organism:Rattus norvegicus (Rat)
Description:P70579
Residue:908
Sequence:
MVCEGKRLASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KERCPGYIGLCPRMVTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINN
KSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAVVPVFIAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
TIIDYGEQRTLDPENARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293743
n/a
NameBDBM50293743
Synonyms:CHEMBL556667 | N-(3-chlorophenyl)picolinamide | cid_836002
TypeSmall organic molecule
Emp. Form.C12H9ClN2O
Mol. Mass.232.666
SMILESClc1cccc(NC(=O)c2ccccn2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: