BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 7 (mGlu7)
LigandBDBM50293721
Substrate/Competitorn/a
Meas. Tech.Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR7
EC50 445000±n/a nM
Citation PubChem PC Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR7 PubChem Bioassay (2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Metabotropic glutamate receptor 7 (mGlu7)
Name:Metabotropic glutamate receptor 7 (mGlu7)
Synonyms:Metabotropic glutamate receptor | mGlu7
Type:Enzyme
Mol. Mass.:102244.48
Organism:Rattus norvegicus (Rat)
Description:P35400
Residue:915
Sequence:
MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRHVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPSSVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293721
n/a
NameBDBM50293721
Synonyms:CHEMBL562551 | N-(4-chloro-3-methoxyphenyl)picolinamide | cid_44191096
TypeSmall organic molecule
Emp. Form.C13H11ClN2O2
Mol. Mass.262.692
SMILESCOc1cc(NC(=O)c2ccccn2)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: