new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetglutamate receptor, metabotropic 4 precursor
LigandBDBM50293743
Substrate/Competitorn/a
Meas. Tech.Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR4
EC50 9840±n/a nM
Citation PubChem PC Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR4 PubChem Bioassay (2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
glutamate receptor, metabotropic 4 precursor
Name:glutamate receptor, metabotropic 4 precursor
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:101878.86
Organism:Rattus norvegicus
Description:gi_12083595
Residue:912
Sequence:
MSGKGGWAWWWARLPLCLLLSLYAPWVPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVRALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQ
KSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARGIIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPRSICSLPCQPGERKKTVKGMACCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPIPIVKLEWDSPWAVLPLFLAVVGIA
ATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFILISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLETPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293743
n/a
NameBDBM50293743
Synonyms:CHEMBL556667 | N-(3-chlorophenyl)picolinamide | cid_836002
TypeSmall organic molecule
Emp. Form.C12H9ClN2O
Mol. Mass.232.666
SMILESClc1cccc(NC(=O)c2ccccn2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: