new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1/M5 chimeric protein
LigandBDBM50258656
Substrate/Competitorn/a
Meas. Tech.Discovery of Novel Allosteric Modulators of the Muscarinic Receptor M5: Fold-shift Assay
EC50 0.512±n/a nM
Citation PubChem PC Discovery of Novel Allosteric Modulators of the Muscarinic Receptor M5: Fold-shift Assay PubChem Bioassay (2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Muscarinic acetylcholine receptor M1/M5 chimeric protein
Name:Muscarinic acetylcholine receptor M1/M5 chimeric protein
Synonyms:Muscarinic acetylcholine receptor | Muscarinic acetylcholine receptor M5 | muscarinic acetylcholine receptor M5
Type:PROTEIN
Mol. Mass.:60102.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1517990
Residue:532
Sequence:
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50258656
n/a
NameBDBM50258656
Synonyms:1-(4-methoxybenzyl)-5-(trifluoromethoxy)indoline-2,3-dione | CHEMBL466253 | VU0238429 | cid_42633508
TypeSmall organic molecule
Emp. Form.C17H12F3NO4
Mol. Mass.351.2767
SMILESCOc1ccc(CN2C(=O)C(=O)c3cc(OC(F)(F)F)ccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: