| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-5 |
|---|
| Ligand | BDBM32761 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kallikrein 5 1536 HTS Dose Response Confirmation |
|---|
| IC50 | 510.78±n/a nM |
|---|
| Citation |  PubChem, PC Kallikrein 5 1536 HTS Dose Response Confirmation PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Kallikrein-5 |
|---|
| Name: | Kallikrein-5 |
|---|
| Synonyms: | KLK5 | KLK5_HUMAN | Kallikrein 5 | SCTE | kallikrein-related peptidase 5 preproprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32031.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_12584 |
|---|
| Residue: | 293 |
|---|
| Sequence: | MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
|
|
|
|---|
| BDBM32761 |
|---|
| n/a |
|---|
| Name | BDBM32761 |
|---|
| Synonyms: | 2-furancarboxylic acid [5-amino-1-(4-methoxyphenyl)sulfonyl-3-pyrazolyl] ester | Furan-2-carboxylic acid 5-amino-1-(4-methoxy-benzenesulfonyl)-1H-pyrazol-3-yl ester | MLS000033887 | SMR000014916 | US11584714, Compound 40# | [5-amino-1-(4-methoxyphenyl)sulfonylpyrazol-3-yl] furan-2-carboxylate | [5-azanyl-1-(4-methoxyphenyl)sulfonyl-pyrazol-3-yl] furan-2-carboxylate | cid_653862 | furan-2-carboxylic acid [5-amino-1-(4-methoxyphenyl)sulfonyl-pyrazol-3-yl] ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13N3O6S |
|---|
| Mol. Mass. | 363.345 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)n1nc(OC(=O)c2ccco2)cc1N |
|---|
| Structure | 
|
|---|
Search and Browse
