Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate Synthase (TS)
LigandBDBM18769
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7±0
Temperature293.15±0 K
Ki>4.02e+5± 0 nM
Citation Ferrari SCosti PMWade RC Inhibitor specificity via protein dynamics: insights from the design of antibacterial agents targeted against thymidylate synthase. Chem Biol 10:1183-93 (2003) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thymidylate Synthase (TS)
Name:Thymidylate Synthase (TS)
Synonyms:TSase
Type:Enzyme
Mol. Mass.:34362.44
Organism:Pneumocystis carinii
Description:n/a
Residue:297
Sequence:
MVNAEEQQYLNLVQYIINHGEDRPDRTGTGTLSVFAPSPLKFSLRNKTFPLLTTKRVFIR
GVIEELLWFIRGETDSLKLREKNIHIWDANGSREYLDSIGLTKRQEGDLGPIYGFQWRHF
GAEYIDCKTNYIGQGVDQLANIIQKIRTSPYDRRLILSAWNPADLEKMALPPCHMFCQFY
VHIPSNNHRPELSCQLYQRSCDMGLGVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCH
IYKDHIEALQQQLTRSPRPFPTLSLNRSITDIEDFTLDDFNIQNYHPYETIKMKMSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18769
n/a
NameBDBM18769
Synonyms:1,8-naphthalein derivative, 17 | 4,4-bis(3-fluoro-4-hydroxyphenyl)-3-oxatricyclo[7.3.1.0^{5,13}]trideca-1(12),5,7,9(13),10-pentaen-2-one | CHEMBL303171 | Phenolnaphthalein derivative, 1
TypeSmall organic molecule
Emp. Form.C24H14F2O4
Mol. Mass.404.3624
SMILESOc1ccc(cc1F)C1(OC(=O)c2cccc3cccc1c23)c1ccc(O)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: