Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG1/S-specific cyclin-E1
LigandBDBM59097
Substrate/Competitorn/a
Meas. Tech.Kinase Inhibition Assay
IC50 2.2e+2± 0 nM
Citation McInnes CWang SAnderson SO'Boyle JJackson WKontopidis GMeades CMezna MThomas MWood GLane DPFischer PM Structural determinants of CDK4 inhibition and design of selective ATP competitive inhibitors. Chem Biol 11:525-34 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G1/S-specific cyclin-E1
Name:G1/S-specific cyclin-E1
Synonyms:CCNE | CCNE1
Type:Enzyme Subunit
Mol. Mass.:47073.17
Organism:Homo sapiens (Human)
Description:n/a
Residue:410
Sequence:
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM59097
n/a
NameBDBM59097
Synonyms:Aminopyrimidine, 10
TypeSmall organic molecule
Emp. Form.C19H23N7S
Mol. Mass.381.498
SMILESCNc1nc(C)c(s1)-c1ccnc(Nc2ccc(cc2)N2CCNCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: