Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrodipicolinate reductase (DHPR)
LigandBDBM59101
Substrate/Competitorn/a
Meas. Tech.Steady-State Inhibition Assay
pH7.4±0
Ki 100±0.0 nM
Citation Sem DSBertolaet BBaker BChang ECostache ADCoutts SDong QHansen MHong VHuang XJack RMKho RLang HMa CTMeininger DPellecchia MPierre FVillar HYu L Systems-based design of bi-ligand inhibitors of oxidoreductases: filling the chemical proteomic toolbox. Chem Biol 11:185-94 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dihydrodipicolinate reductase (DHPR)
Name:Dihydrodipicolinate reductase (DHPR)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:28751.25
Organism:Escherichia coli
Description:P04036
Residue:273
Sequence:
MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV
TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD
IAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAH
ALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSR
MTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM59101
n/a
NameBDBM59101
Synonyms:Bi-ligand, 4
TypeSmall organic molecule
Emp. Form.C21H15N3O8S3
Mol. Mass.533.555
SMILESOc1ccc(\C=C2/SC(=S)N(CC(=O)NCCSc3cc(nc(c3)C([O-])=O)C([O-])=O)C2=O)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: