Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose 5-phosphate reductoisomerase
LigandBDBM59099
Substrate/Competitorn/a
Meas. Tech.Steady-State Inhibition Assay
pH7.4±0
Ki 1.0e+4± 0 nM
Citation Sem DSBertolaet BBaker BChang ECostache ADCoutts SDong QHansen MHong VHuang XJack RMKho RLang HMa CTMeininger DPellecchia MPierre FVillar HYu L Systems-based design of bi-ligand inhibitors of oxidoreductases: filling the chemical proteomic toolbox. Chem Biol 11:185-94 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Name:1-deoxy-D-xylulose 5-phosphate reductoisomerase
Synonyms:1-Deoxy-D-xylulose 5-phosphate reductoisomerase (DXP) | 1-Deoxyxylulose 5-phosphate reductoisomerase (DXR) | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXR) | 2-C-methyl-D-erythritol 4-phosphate synthase | DXP reductoisomerase
Type:Protein
Mol. Mass.:43384.52
Organism:Escherichia coli
Description:P45568
Residue:398
Sequence:
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM59099
n/a
NameBDBM59099
Synonyms:Bi-ligand, 2
TypeSmall organic molecule
Emp. Form.C22H20Cl2N2O4S2
Mol. Mass.511.441
SMILESOc1ccc(\C=C2/SC(=S)N(CCCCC(=O)NCc3ccc(Cl)c(Cl)c3)C2=O)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: